PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g026430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 158aa    MW: 18603.9 Da    PI: 6.7903
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g026430.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.85.8e-21465157
                      TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      ++ R+++t+eq+++L +lF++  r+p+++++++++++l    +++ ++V++WFqN++a+e++
  Sopen03g026430.1  4 KCGRWNPTAEQVKVLTDLFRSgLRTPTTDQIQKISSQLsfygNIESKNVFYWFQNHKARERQ 65
                      568*****************99**************************************97 PP

2Wus_type_Homeobox113.41.2e-36467265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt+eQ+k+L++l++sGlrtP++++iq+i+++L+ yG+ie+kNVfyWFQN+kaRerqk+
   Sopen03g026430.1  4 KCGRWNPTAEQVKVLTDLFRSGLRTPTTDQIQKISSQLSFYGNIESKNVFYWFQNHKARERQKR 67
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.013166IPR001356Homeobox domain
SMARTSM003892.6E-4370IPR001356Homeobox domain
PfamPF000465.1E-18565IPR001356Homeobox domain
SuperFamilySSF466891.45E-11668IPR009057Homeodomain-like
CDDcd000869.19E-5767No hitNo description
Gene3DG3DSA:1.10.10.609.5E-9765IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MGTKCGRWNP TAEQVKVLTD LFRSGLRTPT TDQIQKISSQ LSFYGNIESK NVFYWFQNHK  60
ARERQKRRRK VLVDETNNDE DMRIQLDNIS SNKQINSNHD TDERVIETLQ LFPLNSYAET  120
EKLRLFTEEY MKENMTLSCS IGAEMDHPTL DLRLSFFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-155HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235459.11e-115PREDICTED: WUSCHEL-related homeobox 5-like
SwissprotQ8H1D24e-56WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLK4BJ521e-115K4BJ52_SOLLC; Uncharacterized protein
STRINGSolyc03g096300.2.11e-115(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA122011922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.12e-57WUSCHEL related homeobox 5